General Information

  • ID:  hor006713
  • Uniprot ID:  P01220(25-120)
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Equus caballus (Horse)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0006590 thyroid hormone generation; GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  FPDGEFTTQDCPECKLRENKYFFKLGVPIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI
  • Length:  96(25-120)
  • Propeptide:  MDYYRKHAAVILATLSVFLHILHSFPDGEFTTQDCPECKLRENKYFFKLGVPIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI
  • Signal peptide:  MDYYRKHAAVILATLSVFLHILHS
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-P01220-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006713_AF2.pdbhor006713_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1272254 Formula: C485H757N133O137S12
Absent amino acids: W Common amino acids: CKT
pI: 8.71 Basic residues: 17
Polar residues: 37 Hydrophobic residues: 24
Hydrophobicity: -34.06 Boman Index: -16317
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 55.83
Instability Index: 4466.35 Extinction Coefficient cystines: 8075
Absorbance 280nm: 85

Literature

  • PubMed ID:  3437252
  • Title:  Nucleotide (cDNA) sequence encoding the horse gonadotrophin alpha-subunit.
  • PubMed ID:  670201
  • Title:  Isolation and amino acid sequence of the alpha-subunit of follicle-stimulating hormone from equine pituitary glands.